Browsing by Author "Khairijon"
Now showing 1 - 11 of 11
Results Per Page
Sort Options
Item AKUMULASI BIOMASSA DAN KARBON TERSIMPAN PADA EKOSISTEM MANGROVE YANG TERDEGRADASI DI DESA TANJUNG LEBAN, BENGKALIS(2016-10-12) Pratama, Arie; Khairijon; Gunawan, HarisMangrove forest is a forest that occur in coastal area that influenced by the tide and can absorb a large carbon stocks. Biomass produced by mangrove ecosystem is higher than tropical forest ecosystems. The condition of mangrove forest ecosystem has decreased due to human activities. This research aimed to estimate the total biomass and carbon on the surface of mangrove forest ecosystem that have been degraded in Tanjung Leban, Bengkalis. The research used survey method with observed parameters were temperature, pH, and salinity. In this study, two locations were studied, with three transects each location. For each transect, five plot (20 x 20 m) were made. A total of five species were found in study, i.e.Brugueira cilindrica, Rhizopora apiculata, Rhizopora mucronata, Avicennia marina, and Xilocarpus granatum. The vegetation was dominated by Rhizopora mucronata with a density of 455 individu/ha. The result showed that the highest total biomass and carbon stock was found in the location 1 with a value of 52.85508 ton/ha and 26.427538 ton/ha. The lowest total biomass and carbon stock was found in location 2 with a value of 0,571336 ton/ha and 0,285668 ton/ha. Biomass and carbon stocks are influenced by soil physico-chemical parameter, the diameter and density of trees. If the value of physical-chemical soil parameters obtained was higher, the value of biomass and carbon stocks generated was also higher.Item KELIMPAHAN MEIOFAUNA DI KAWASAN MANGROVE DESA BASILAM BARU DUMAI, PROVINSI RIAU(2013-07-16) Neri, Elfi; Mahatma, Radith; KhairijonThe information of meiofauna abundance from Indonesia mangrove is still scarce. This research aimed to know the abundance of meiofauna from mangrove area in Basilam Baru village. Samples were collected using corer from sediment that dominated four different mangrove vegetations i.e. Rhizopora apiculata, Xylocarpus granatum, sonneratia alba and Avicennia alba. A total of 4144 meiofauna which consisted of Copepoda, Nematoda, Nemertina, Olygochaeta, Ostracoda, Polichaeta and Thermosbaenacea were found in this study. The total of meiofauna abundance that found in mangrove area of Basilam Baru village was 682,03 ind/10cm2. The average abundance of meiofauna within the four different mangrove vegetations was significantly different (P<0,05). The most dominant meiofauna was Nematode followed by Copepode. The highest abundance of meiofauna was found around Avicennia alba and the lowest abundance was found around Xylocarpus granatum.Item KOMUNITAS MEIOFAUNA DI KAWASAN MANGROVE BANDAR BAKAU DUMAI PROVINSI RIAU(2013-07-16) Nurmalisyah; Mahatma, Radith; KhairijonThis research was conducted to determine the community structure (composition and abundance) of meiofauna from mangrove areas in Bandar Bakau Dumai, Riau Province. Samples were collected from sediment which dominated by four different mangrove vegetations i.e. Sonneratia alba, Xylocarpus granatum, Avicennia alba and Rhizophora apiculata. The number of taxa found in the study was 11 taxa, they were Nematoda, Copepoda, Oligochaeta, Ostracoda, Turbellaria, Foraminifera, Ciliophora, Polychaeta, Isopoda, Kinorhyncha, and Holothuroidea. The average of meiofauna abundance found in sediment dominated by Sonneratia alba, Xylocarpus granatum, Avicennia alba, Rhizophora apiculata were 544,8 ind/10 cm2, 140,8 ind/10 cm2, 111,92 ind/10 cm2 and 22,7 ind/10 cm2 respectively. The abundance of meiofauna vegetation was significantly different (F= 9,20; P<0,05). The abundance of Harpacticoid Copepod was 895.98 Ind/10 cm 2. Diosaccidae was the most dominant Harpacticoid family found this study.Item KUALITAS PERAIRAN SUNGAI SAIL KOTA PEKANBARU BERDASARKAN KOEFISIEN SAPROBIK(2013-07-19) Putra, Rendy Perdana; Elvyra, Roza; KhairijonSail river is a tributary of the Siak river, located in Pekanbaru. Sail river is used by local people as a fishing ground as well as a place to dispose domestic waste that cause water pollution. The purpose of this research is to determine the water quality of Sail river in Pekanbaru according to the distribution and abundance of plankton organism using saprobic coefficient. Plankton was sampled by filtering 50L river water at 3 stations using a plankton net no.25 and preserved with 1% lugol. Water physical and chemical parameters at each station were also measured. During this study, the phytoplankton which was found consists of 4 classes: Bacillaryophyceae (13 spesies), Chlorophyceae (10 spesies), Euglenaphyceae (2 spesies) and Phyrophyceae (1 spesies). The zooplankton which was also found consists of only one class: Cilliata (3 spesies). Saprobic coefficient were ranged from -1 to +1. The abundance of the planktons were ranged from 6,72 ind/L to 96,6 ind/L. Saprobitas phases obtained during this study were β-mesosaprobic, α/β-mesosaprobic, β/α-mesosaprobic, and α-mesosaprobic. Based on those indexes Sail river was categorized into a river of moderate to heavy polluted. Content of pollutant based on saprobitas phases were grouped into organic + anorganic materials for moderate polluted and organic material for heavy polluted.Item PENGARUH KONDISI MANGROVE TERHADAP KELIMPAHAN KEPITING BIOLA (Uca sp) DI EKOSISTEM MANGROVE SUNGAI RAWA(2020-06) Alfian, Muhammad Aldi Fratama; Khairijon; Mahatma, RadithViddler crab is a type of crab that lives in holes or soaks in the substrate of mangrove ecosystem. This research was conducted from January to April 2020 in the Sungai Rawa Mangrove Ecotourism Area. The purpose of this study was to determine and obtain correlation values between condition of mangrove ecosystem and the abundance of viddler crabs. Survey method used in this research was purposive sampling technique. This study found 7 types of mangroves namely Avicennia marina, Avicennia alba, Avicennia officinalis, Sonneratia alba, Sonneratia ovata, Rhizophora mucronata, Rhizophora apiculata. The mangrove condition at the observed station was in the rare (damaged) category. Mangrove density in transect 1, 2 and 3 were 775 trees/ha, 375 trees /ha, and 200 trees /ha, respectively. The highest abundance of viddler crab was 4500 ind /ha found in station 1, while the lowest abundance was in station 2 where fiddler crab species was not found. The correlation between the existence of viddler crab and mangrove density showed a strong positive relationship. It means that the higher value of mangrove density leads to the high abundance of viddler crabItem PRODUKSI SERASAH RHIZOPHORA DI KAWASAN HUTAN MANGROVE DESA SUNGAI RAWA KECAMATAN SUNGAI APIT KABUPATEN SIAK, RIAU(2014-03-28) Yanti, Siska Rahma; Khairijon; Sofiyanti, NerySungai Rawa Village, Sungai Apit District, Siak Regency is one of regions in Riau Province that has mangrove forest. Some mangrove species, including Rhizophora sp., are found in this forest. The aim of this research was to analyzed the litter production of Rhizophora. The study area was divided into three zones : Zone I, Zone II, and Zone III. A total of 10 litter traps, 50cm x 50cm x 50cm in size, were placed in each zone using a purposive sampling method. Each litter trap was collected every 2 weeks for three months which are April, May and June 2013. The litter was analyzed by measuring the dry weight. The envinronment parameters observed in this study were rainfall, air temperature, humidity, salinity and density of Rhizophora. The highest litter production of Rhizophora for three months was found in Zone II (794,5 gr/m 2/month). The litter production was higher in April than the other months which is 299,9 gr/m2 /month.Item STATUS REGENERASI VEGETASI POHON SIALANG DI DESA DUNDANGAN, KABUPATEN PELALAWAN(2013-07-30) Perial, Peri; Khairijon; FitmawatiThis study aimed to determine the regeneration status of Sialang tree. This study had been conducted from November 2012 to December 2012 in Kepung Sialang forest, Dundangan Village, Pangkalan Kuras, Pelalawan District, Riau Province. The method used in this study was purposive sampling method, by placing nested plot around Sialang stree. A total of 25 plots were examined. The size of plot for tree, pole, sapling and seedling were 20 x 20 m, 10 x 10 m, 5 x 5 m and 2 x 2 m respectively. The result showed that there are six Sialang trees, i.e Rumah Keluang tree (Dipterocarpus confertus Sloot.), Kempas (Koompassia malaccensis), Sulur Batang (Shorea sp), Kayu Batu (Irvingia malayena), Kedondong (Spondias pinnata) and Ara (Ficus benjamina). The vegetation structure of Sialang tree at seedling stage was dominated by Sulur Batang, while for sapling and tree were dominated by Rumah Keluang. The highest Important Value Indexs for tree, pole, sapling and seedling were 154.8556 (Rumah keluang), 300 (Rumah Keluang), 146.2927 (Rumah keluang), 123,20707 (Sulur Batang), respectively. Keluang tree (Dipterocarpus confertus Sloot.) had the best regeneration status. Morista distribution index for all of the Sialang trees showed a clustered distribution.Item STRUKTUR KOMUNITAS MAKROFAUNA DI KAWASAN MANGROVE DESA TANJUNG LEBAN DAN BUKIT BATU, KABUPATEN BENGKALIS(2016-01-28) Afrimaini; Mahatma, Radith; KhairijonInformation on community structure of macrofauna in Indonesian mangrove areas is still limited. The aimed of this research was to assess the community structure and abundance of macrofauna in Tanjung Leban and Bukit Batu, Bengkalis Regency. Sampling of macrofauna was conducted on September 2014. Samples ware collected using corer in 10 plots for each mangrove area with 3 replications on each plot. The result showed that the macrofauna composition was about 1277 individuals consisted of taxa namely Nematoda, Gastropoda, Copepoda, Bivalva, Polychaeta, Oligochaeta, Tardigrada, Insecta, Holothuroidea, Ostracoda dan Syncarida. The total abundance of macrofauna was3347,49 ind/m2. Macrofauna taxa which most dominant in this area research were Nematoda, Gastropoda and Copepoda. ANOVA analysis on each plots showed the result was not significantly different (Tanjung Leban Fhit=0,96; P>0,05, Bukit Batu Fhit=0,86 P>0,05). Test-t analysis on the average abundance of macrofauna between these two mangrove areas wasalso not significantly different (P>0,05).Item STRUKTUR KOMUNITAS MEIOFAUNA DI KAWASAN MANGROVE DESA BUKIT BATU DAN TANJUNG LEBAN, KABUPATEN BENGKALIS(2016-01-28) Arni, Dewi Putri; Mahatma, Radith; KhairijonThe information of meiofauna community structure of mangrove areas in Indonesia is still limited compared to the mangrove area. This study aimed to assess the community structure and abundance of meiofauna in mangrove areas, Desa Bukit Batu and Tanjung Leban, Bengkalis Regency. Samples were collected from plots that ditributed on transect line based on the lowest and highest tide point. Meiofauna abundance in each plot between the two villages were analyzed with ANOVA, while the difference between meiofauna abundance of these two villages was performed by t test. The result indicated that meiofauna which were found at the study site consisted of 5 taxa namely, Nematodes, Copepods, Ostracoda, Olygochaeta and Polychaeta. The average abundance of meiofauna was 31,62 ind/10 cm2. It was also found that Nematodes was the most abundance taxa followed by Copepoda at all villages. One way ANOVA results showed the abundance of meiofauna in each plot was not significantly different (Desa Bukit Batu: Fhit = 0.78, P >0.05 and Desa Tanjung Leban: Fhit = 1.61 (P >0.05). While the abundance of meiofauna between two villages performed by t test was significantly different states (Thit = -4,60 P< 0.05).Item STRUKTUR KOMUNITAS MEIOFAUNA DI KAWASAN MANGROVE DESA TELUK UMA KABUPATEN KARIMUN(2014-04-14) Suryani; Mahatma, Radith; KhairijonInformation on meiofauna community structure in Indonesian mangrove areas is still limited compared to its vast areas. This study aimed to assess the community structure and abundance of meiofauna on four stations in mangrove areas, located in Teluk Uma Village, Karimun Regency. Samples were collected from four stations. Station 1, 2, and 3 are dominated by mangrove vegetation Rhizophora sp., Avicennia sp., Bruguiera sp., consecutively while station 4 is located in an area without mangrove vegetation (Coral Sand). Meiofauna abundance was analyzed using one-way ANOVA and Fisher's test. The result indicated that meiofauna which were found at the study site consisted of 12 taxa namely, Nematodes, Copepods, Polychaeta, Turbellarian, Cumacea, Oligochaeta, Holothuroidea, Syncarida, Isopoda, Ostracoda, Cnidaria, and Tardigrada. The average abundance of meiofauna was 3.22 ind/10 cm 2 . It was also found that Nematodes was the most abundance taxa followed by Copepoda and Polychaeta at all stations. One-way ANOVA results revealed that the abundance of meiofauna in each station was significantly different (F=3.52 P<0.05).Item STRUKTURKOMUNITASTUMBUHANBAWAHBERPOTENSI INVASIFDIKAWASANTAMANWISATAALAMBULUHCINA,SIAK HULU,KAMPAR(2020-05) junia, Melvi; KhairijonThisstudyaimedtoknow thestructureandcompositionofinvasivelower plantsinthe BuluhCinaNaturePark.Researchonthestructureofinvasive lowerplantcommunitieswasconductedinSeptembertoOctober2019.The methodusedwas linetransectmethodthroughtpurposivesamplingwith3 transectlinesalong100m.Eachtransectwasmadeasmanyas10plots(5x5 m)alternatelywithadistanceof5m.Theresultsfound40speciesfrom 14 familieswithatotalof1.576individuals.Therewerefivespeciesthatdominate andmostptentiallybecameinvasiveinlayingareaoftransectone,ninespecies inlayingareaoftransecttwoandsevenspeciesinlayingareatransectthree. Invasiveplantthathadthehighestdiversityindexinthelayingareaoftransect one,wasUrochloaglumaris(17,55%),Ageratum conyzoides(22,89%)inthe transectlayingareatwoandDigitarialongiflora(63,63%)inthetransectlaying areathreehighestdiversityindex(H’)wasobtained inthelaying areaof transectone(3,075)